Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50395587
Substrate/Competitorn/a
Meas. Tech.ChEMBL_859668
Ki 0.6±n/a nM
Citation Chen XSassano MFZheng LSetola VChen MBai XFrye SVWetsel WCRoth BLJin J Structure-functional selectivity relationship studies ofß-arrestin-biased dopamine D2 receptor agonists. J Med Chem 55:7141-53 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395587
n/a
NameBDBM50395587
Synonyms:CHEMBL2165126 | UNC10000006 | US9156822, 2
TypeSmall organic molecule
Emp. Form.C24H29Cl2N3O2
Mol. Mass.462.412
SMILESClc1cccc(N2CCCN(CCCCOc3ccc4CCC(=O)Nc4c3)CC2)c1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: