Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase A1 |
---|
Ligand | BDBM50395590 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_859685 (CHEMBL2169120) |
---|
Ki | 71000±n/a nM |
---|
Citation | Koutsoumpli, GE; Dimaki, VD; Thireou, TN; Eliopoulos, EE; Labrou, NE; Varvounis, GI; Clonis, YD Synthesis and study of 2-(pyrrolesulfonylmethyl)-N-arylimines: a new class of inhibitors for human glutathione transferase A1-1. J Med Chem55:6802-13 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutathione S-transferase A1 |
---|
Name: | Glutathione S-transferase A1 |
Synonyms: | GST class-alpha member 1 | GST-epsilon | GSTA1 | GSTA1-1 | GSTA1_HUMAN | GTH1 | Glutathione S-transferase (GST) | HA subunit 1 |
Type: | Enzyme |
Mol. Mass.: | 25636.31 |
Organism: | Homo sapiens (Human) |
Description: | Glutathione-S-Transferase (GST, N-terminally) |
Residue: | 222 |
Sequence: | MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
|
|
|
BDBM50395590 |
---|
n/a |
---|
Name | BDBM50395590 |
Synonyms: | CHEMBL2165141 |
Type | Small organic molecule |
Emp. Form. | C19H17N3O4S |
Mol. Mass. | 383.421 |
SMILES | Cn1cccc1S(=O)(=O)Cc1ccccc1\N=C\c1ccc(cc1)[N+]([O-])=O |
Structure |
|