Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase B
LigandBDBM50395738
Substrate/Competitorn/a
Meas. Tech.ChEMBL_860206
IC50 1400±n/a nM
Citation Yoshimoto NSasaki TSugimoto KIshii HYamamoto K Design and characterization of a selenium-containing inhibitor of activated thrombin-activatable fibrinolysis inhibitor (TAFIa), a zinc-containing metalloprotease. J Med Chem 55:7696-705 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase B
Name:Carboxypeptidase B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47371.10
Organism:Sus scrofa
Description:ChEMBL_453905
Residue:416
Sequence:
MLAFLILVTVTLASAHHSGEHFEGEKVFRVNVEDENDISLLHELASTRQIDFWKPDSVTQ
IKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSRVRTTGHSYEKYN
NWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVGKPGPNKPAIFMDCGFHAREW
ISHAFCQWFVREAVLTYGYESHMTEFLNKLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTN
AGTTCIGTDPNRNFDAGWCTTGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAY
LTIHSYSQMILYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTNYVLGHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395738
n/a
NameBDBM50395738
Synonyms:CHEMBL2164456
TypeSmall organic molecule
Emp. Form.C10H19NO3S
Mol. Mass.233.328
SMILESCC(=O)SCC(CCCCCN)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: