Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclin-Dependent Kinase 5 (CDK5)
LigandBDBM50395892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858032
Ki 110±n/a nM
Citation Tell VHolzer MHerrmann LMahmoud KASchächtele CTotzke FHilgeroth A Multitargeted drug development: Discovery and profiling of dihydroxy substituted 1-aza-9-oxafluorenes as lead compounds targeting Alzheimer disease relevant kinases. Bioorg Med Chem Lett 22:6914-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclin-Dependent Kinase 5 (CDK5)
Name:Cyclin-Dependent Kinase 5 (CDK5)
Synonyms:CDK5/p35 | Cyclin-dependent kinase 5 regulatory subunit 1 | Cyclin-dependent kinase 5/CDK5 activator 1
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cyclin-T1/Cyclin-dependent-like kinase 5
Synonyms:CDK5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 (CDK5)
Type:Enzyme Subunit
Mol. Mass.:33308.61
Organism:Homo sapiens (Human)
Description:n/a
Residue:292
Sequence:
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Cyclin-dependent kinase 5 regulatory subunit 1
Synonyms:Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | TPKII regulatory subunit | p35
Type:Enzyme Subunit
Mol. Mass.:34077.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:307
Sequence:
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395892
n/a
NameBDBM50395892
Synonyms:CHEMBL2163772
TypeSmall organic molecule
Emp. Form.C17H11NO3
Mol. Mass.277.2741
SMILESOc1ccc2oc3ncc(O)c(-c4ccccc4)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: