Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C iota (PKCι)
LigandBDBM50395892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858039
Ki>1000000±n/a nM
Citation Tell VHolzer MHerrmann LMahmoud KASchächtele CTotzke FHilgeroth A Multitargeted drug development: Discovery and profiling of dihydroxy substituted 1-aza-9-oxafluorenes as lead compounds targeting Alzheimer disease relevant kinases. Bioorg Med Chem Lett 22:6914-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C iota (PKCι)
Name:Protein kinase C iota type/zeta type
Synonyms:Atypical protein kinase C-lambda/iota | PRKC-lambda/iota | Protein kinase C (PKC) | Protein kinase C iota | Protein kinase C iota type | aPKC-lambda/iota | nPKC-iota
Type:Enzyme
Mol. Mass.:68251.56
Organism:Homo sapiens (Human)
Description:P41743
Residue:596
Sequence:
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395892
n/a
NameBDBM50395892
Synonyms:CHEMBL2163772
TypeSmall organic molecule
Emp. Form.C17H11NO3
Mol. Mass.277.2741
SMILESOc1ccc2oc3ncc(O)c(-c4ccccc4)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: