Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C, gamma
LigandBDBM50395892
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858037
Ki>1000000±n/a nM
Citation Tell VHolzer MHerrmann LMahmoud KASchächtele CTotzke FHilgeroth A Multitargeted drug development: Discovery and profiling of dihydroxy substituted 1-aza-9-oxafluorenes as lead compounds targeting Alzheimer disease relevant kinases. Bioorg Med Chem Lett 22:6914-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C, gamma
Name:Protein kinase C, PKC; classical/novel
Synonyms:PKC gamma | PKC-gamma | Protein kinase C gamma | Protein kinase C gamma type
Type:Enzyme
Mol. Mass.:78458.05
Organism:Homo sapiens (Human)
Description:The recombinant human PKC enzymes were produced using a baculovirus expression system in SF9 cells
Residue:697
Sequence:
MAGLGPGVGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395892
n/a
NameBDBM50395892
Synonyms:CHEMBL2163772
TypeSmall organic molecule
Emp. Form.C17H11NO3
Mol. Mass.277.2741
SMILESOc1ccc2oc3ncc(O)c(-c4ccccc4)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: