Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUDP-3-O-acyl-N-acetylglucosamine deacetylase
LigandBDBM50395895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_858075
IC50 6.81±n/a nM
Citation McAllister LAMontgomery JIAbramite JAReilly UBrown MFChen JMBarham RAChe YChung SWMenard CAMitton-Fry MMullins LMNoe MCO'Donnell JPOliver RMPenzien JBPlummer MPrice LMShanmugasundaram VTomaras APUccello DP Heterocyclic methylsulfone hydroxamic acid LpxC inhibitors as Gram-negative antibacterial agents. Bioorg Med Chem Lett 22:6832-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
UDP-3-O-acyl-N-acetylglucosamine deacetylase
Name:UDP-3-O-acyl-N-acetylglucosamine deacetylase
Synonyms:lpxC
Type:PROTEIN
Mol. Mass.:21890.40
Organism:Pseudomonas aeruginosa
Description:ChEMBL_858075
Residue:197
Sequence:
TVEHLLSAMAGLGIDNAYVELSASEVPIMDGSAGPFVFLIQSAGLQEQEAAKKFIRIKRE
VSVEEGDKRAVFVPFDGFKVSFEIDFDHPVFRGRTQQASVDFSSTSFVKEVSRARTFGFM
RDIEYLRSQNLALGGSVENAIVVDENRVLNEDGLRYEDEFVKHKILDAIGDLYLLGNSLI
GEFRGFKSGHALNNQLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50395895
n/a
NameBDBM50395895
Synonyms:CHEMBL2164194
TypeSmall organic molecule
Emp. Form.C15H16F2N2O5S
Mol. Mass.374.36
SMILESCC(CCc1cc(no1)-c1cccc(F)c1F)(C(=O)NO)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: