Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H1
LigandBDBM50396025
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861232
IC50>10000±n/a nM
Citation Decarlo DHadden MK Oncoepigenomics: making histone lysine methylation count. Eur J Med Chem 56:179-194 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H1
Name:Histone-lysine N-methyltransferase SUV39H1
Synonyms:H3-K9-HMTase 1 | Histone H3-K9 methyltransferase 1 | KMT1A | Lysine N-methyltransferase 1A | Position-effect variegation 3-9 homolog | SUV39H | SUV39H1 | Su(var)3-9 homolog 1 | Suppressor of variegation 3-9 homolog 1
Type:PROTEIN
Mol. Mass.:47917.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1473655
Residue:412
Sequence:
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396025
n/a
NameBDBM50396025
Synonyms:CHEMBL1089088
TypeSmall organic molecule
Emp. Form.C17H22N2O5S2
Mol. Mass.398.497
SMILESCS[C@@]12CC3=CC=C[C@H](OC(C)=O)[C@H]3N1C(=O)[C@@](CO)(SC)N(C)C2=O |r,c:6,t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: