Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H1
LigandBDBM50396026
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861232
IC50 530±n/a nM
Citation Decarlo DHadden MK Oncoepigenomics: making histone lysine methylation count. Eur J Med Chem 56:179-194 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H1
Name:Histone-lysine N-methyltransferase SUV39H1
Synonyms:H3-K9-HMTase 1 | Histone H3-K9 methyltransferase 1 | KMT1A | Lysine N-methyltransferase 1A | Position-effect variegation 3-9 homolog | SUV39H | SUV39H1 | Su(var)3-9 homolog 1 | Suppressor of variegation 3-9 homolog 1
Type:PROTEIN
Mol. Mass.:47917.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1473655
Residue:412
Sequence:
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396026
n/a
NameBDBM50396026
Synonyms:CHEMBL2172426
TypeSmall organic molecule
Emp. Form.C30H28N6O4S4
Mol. Mass.664.841
SMILESCN1C(=O)[C@@]23C[C@]4([C@H](Nc5ccccc45)N2C(=O)[C@]1(C)SS3)[C@]12C[C@]34SS[C@](C)(N(C)C3=O)C(=O)N4[C@H]1Nc1ccccc21 |r,TLB:17:16:1.2:20.21,7:15:1.2:20.21,THB:34:33:29.31:26.25,36:35:29.31:26.25|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: