| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM21398 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_861906 (CHEMBL2173634) |
|---|
| Ki | 2.1±n/a nM |
|---|
| Citation |  Díaz, JL; Cuberes, R; Berrocal, J; Contijoch, M; Christmann, U; Fernández, A; Port, A; Holenz, J; Buschmann, H; Laggner, C; Serafini, MT; Burgueño, J; Zamanillo, D; Merlos, M; Vela, JM; Almansa, C Synthesis and biological evaluation of the 1-arylpyrazole class ofs(1) receptor antagonists: identification of 4-{2-[5-methyl-1-(naphthalen-2-yl)-1H-pyrazol-3-yloxy]ethyl}morpholine (S1RA, E-52862). J Med Chem55:8211-24 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM21398 |
|---|
| n/a |
|---|
| Name | BDBM21398 |
|---|
| Synonyms: | 4-[4-(4-Chloro-phenyl)-4-hydroxy-piperidin-1-yl]-1-(4-fluoro-phenyl)-butan-1-one;propionate(HCl) | 4-[4-(4-chlorophenyl)-4-hydroxypiperidin-1-yl]-1-(4-fluorophenyl)butan-1-one | CHEMBL54 | CHEMBL545608 | Haloperidol | Haloperidol, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23ClFNO2 |
|---|
| Mol. Mass. | 375.864 |
|---|
| SMILES | OC1(CCN(CCCC(=O)c2ccc(F)cc2)CC1)c1ccc(Cl)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
