Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C1 |
---|
Ligand | BDBM50134036 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_864307 (CHEMBL2175578) |
---|
Ki | 810±n/a nM |
---|
Citation | Brožic, P; Turk, S; Adeniji, AO; Konc, J; Janežic, D; Penning, TM; Lanišnik Rižner, T; Gobec, S Selective inhibitors of aldo-keto reductases AKR1C1 and AKR1C3 discovered by virtual screening of a fragment library. J Med Chem55:7417-24 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C1 |
---|
Name: | Aldo-keto reductase family 1 member C1 |
Synonyms: | 20-alpha-HSD | 20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) | AK1C1_HUMAN | AKR1C1 | Aldo-keto reductase family 1 member C1 (AK1C1) | Aldo-keto reductase family 1 member C1 (AK1C1a) | Aldo-keto reductase family 1 member C1 (AKR1C1) | Chlordecone reductase homolog HAKRC | DDH | DDH1 | High-affinity hepatic bile acid-binding protein | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36793.97 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant AKR1C1 enzyme was expressed in E. coli. |
Residue: | 323 |
Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
|
|
|
BDBM50134036 |
---|
n/a |
---|
Name | BDBM50134036 |
Synonyms: | 2-(2,3-Dimethyl-phenylamino)-benzoic acid | 2-(2,3-Dimethyl-phenylamino)-benzoic acid(Mefenamic acid) | 2-(2,3-dimethylphenylamino)benzoic acid | CHEMBL686 | CI-473 | CN-35355 | INF-3355 | MEFENAMIC ACID | Ponstel | cid_4044 | mefanamic acid |
Type | Small organic molecule |
Emp. Form. | C15H15NO2 |
Mol. Mass. | 241.2851 |
SMILES | Cc1cccc(Nc2ccccc2C(O)=O)c1C |
Structure |
|