| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50396885 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_862690 (CHEMBL2174238) |
|---|
| Ki | 0.22±n/a nM |
|---|
| Citation |  Meyer, C; Schepmann, D; Yanagisawa, S; Yamaguchi, J; Dal Col, V; Laurini, E; Itami, K; Pricl, S; Wünsch, B Pd-catalyzed direct C-H bond functionalization of spirocyclics1 ligands: generation of a pharmacophore model and analysis of the reverse binding mode by docking into a 3D homology model of thes1 receptor. J Med Chem55:8047-65 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | OPRS1 | SGMR1_CAVPO | SIGMAR1 | Sigma 1-type opioid receptor | Sigma non-opioid intracellular receptor 1 | Sigma-1 receptor | Sigma1-receptor | Sigma1R | Sterol isomerase-like protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25307.17 |
|---|
| Organism: | Cavia porcellus (Guinea pig) |
|---|
| Description: | Q60492 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWLWVALFLAAVAVLTQIVWLWLGTQNFVFQREEIAQLARQYAGLDHELAFSK
LIVELRRLHPVHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSPRHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLGFALADTVFSTQDFLTLFYTLRVYARALQLELTTYLFGQDP
|
|
|
|---|
| BDBM50396885 |
|---|
| n/a |
|---|
| Name | BDBM50396885 |
|---|
| Synonyms: | CHEMBL2170669 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H23NO2S |
|---|
| Mol. Mass. | 329.456 |
|---|
| SMILES | COC1Cc2cscc2C2(CCN(Cc3ccccc3)CC2)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
