Reaction Details |
| Report a problem with these data |
Target | Methylated-DNA--protein-cysteine methyltransferase |
---|
Ligand | BDBM5491 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_863278 (CHEMBL2176221) |
---|
IC50 | 39±n/a nM |
---|
Citation | Zhu, R; Seow, HA; Baumann, RP; Ishiguro, K; Penketh, PG; Shyam, K; Sartorelli, AC Design of a hypoxia-activated prodrug inhibitor of O6-alkylguanine-DNA alkyltransferase. Bioorg Med Chem Lett22:6242-7 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methylated-DNA--protein-cysteine methyltransferase |
---|
Name: | Methylated-DNA--protein-cysteine methyltransferase |
Synonyms: | 6-O-methylguanine-DNA methyltransferase | MGMT | MGMT_HUMAN |
Type: | PROTEIN |
Mol. Mass.: | 21651.27 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_144711 |
Residue: | 207 |
Sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM
QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL
AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG
LGGSSGLAGAWLKGAGATSGSPPAGRN
|
|
|
BDBM5491 |
---|
n/a |
---|
Name | BDBM5491 |
Synonyms: | 6-(benzyloxy)-9H-purin-2-amine | CHEMBL407874 | O6-Substituted Guanine Deriv. 31 |
Type | Small organic molecule |
Emp. Form. | C12H11N5O |
Mol. Mass. | 241.2486 |
SMILES | Nc1nc(OCc2ccccc2)c2[nH]cnc2n1 |
Structure |
|