| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50397109 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_863684 (CHEMBL2175526) |
|---|
| IC50 | 330±n/a nM |
|---|
| Citation |  Mollica, A; Pinnen, F; Stefanucci, A; Mannina, L; Sobolev, AP; Lucente, G; Davis, P; Lai, J; Ma, SW; Porreca, F; Hruby, VJ cis-4-amino-L-proline residue as a scaffold for the synthesis of cyclic and linear endomorphin-2 analogues: part 2. J Med Chem55:8477-82 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50397109 |
|---|
| n/a |
|---|
| Name | BDBM50397109 |
|---|
| Synonyms: | CHEMBL2171847 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H35N5O5 |
|---|
| Mol. Mass. | 569.6508 |
|---|
| SMILES | N[C@@H](Cc1ccc(O)cc1)C(=O)N1C[C@@H]2C[C@H]1C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
