Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM50397360
Substrate/Competitorn/a
Meas. Tech.ChEMBL_864759
IC50 10±n/a nM
Citation Vaidya ASNeelarapu RMadriaga ABai HMendonca EAbdelkarim Hvan Breemen RBBlond SYPetukhov PA Novel histone deacetylase 8 ligands without a zinc chelating group: exploring an 'upside-down' binding pose. Bioorg Med Chem Lett 22:6621-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397360
n/a
NameBDBM50397360
Synonyms:CHEMBL2170177 | US10188756, Compound CN110
TypeSmall organic molecule
Emp. Form.C17H16N2O3
Mol. Mass.296.3205
SMILESCOc1ccc(Cn2ccc3ccc(cc23)C(=O)NO)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: