Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 3
LigandBDBM50397609
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873083
IC50 1100±n/a nM
Citation Bamborough PDiallo HGoodacre JDGordon LLewis ASeal JTWilson DMWoodrow MDChung CW Fragment-based discovery of bromodomain inhibitors part 2: optimization of phenylisoxazole sulfonamides. J Med Chem 55:587-96 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 3
Name:Bromodomain-containing protein 3
Synonyms:Bromodomain-containing protein 3 | Bromodomain-containing protein 3 (BRD3) | RING3-like protein
Type:Protein
Mol. Mass.:79571.81
Organism:Homo sapiens (Human)
Description:Q15059
Residue:726
Sequence:
MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFY
QPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTD
DIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPA
TPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATPIVPVVPPTPPVVKKK
GVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLST
VKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAAL
SQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKA
NSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEEL
AQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSS
DSSDSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397609
n/a
NameBDBM50397609
Synonyms:CHEMBL2181705
TypeSmall organic molecule
Emp. Form.C16H20N2O3S
Mol. Mass.320.407
SMILESCc1noc(C)c1-c1ccc(C)c(c1)S(=O)(=O)N1CCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: