Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG protein-coupled receptor 44
LigandBDBM50397643
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873095
Ki 0.2±n/a nM
Citation Pettipher RWhittaker M Update on the development of antagonists of chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2). From lead optimization to clinical proof-of-concept in asthma and allergic rhinitis. J Med Chem 55:2915-31 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
G protein-coupled receptor 44
Name:G protein-coupled receptor 44
Synonyms:CD_antigen=CD294 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | G-protein coupled receptor 44 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2)
Type:Enzyme
Mol. Mass.:43295.45
Organism:Homo sapiens (Human)
Description:Q9Y5Y4
Residue:395
Sequence:
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397643
n/a
NameBDBM50397643
Synonyms:CHEMBL2181803
TypeSmall organic molecule
Emp. Form.C18H15F2NO4S2
Mol. Mass.411.443
SMILESCc1c(CC(O)=O)c2ccc(F)cn2c1Sc1ccc(cc1F)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: