Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 1C (PDE1C)
LigandBDBM50397843
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876338
IC50 466±n/a nM
Citation Verhoest PRFonseca KRHou XProulx-Lafrance CCorman MHelal CJClaffey MMTuttle JBCoffman KJLiu SNelson FKleiman RJMenniti FSSchmidt CJVanase-Frawley MLiras S Design and discovery of 6-[(3S,4S)-4-methyl-1-(pyrimidin-2-ylmethyl)pyrrolidin-3-yl]-1-(tetrahydro-2H-pyran-4-yl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one (PF-04447943), a selective brain penetrant PDE9A inhibitor for the treatment of cognitive disorders. J Med Chem 55:9045-54 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 1C (PDE1C)
Name:Phosphodiesterase 1C (PDE1C)
Synonyms:Phosphodiesterase 1 | Phosphodiesterase 1C | Phosphodiesterase, PDE1/PDE5
Type:Enzyme
Mol. Mass.:80778.58
Organism:Homo sapiens (Human)
Description:Q14123
Residue:709
Sequence:
MESPTKEIEEFESNSLKYLQPEQIEKIWLRLRGLRKYKKTSQRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIEALKDVDKWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQDDEEMNILINLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
SGVKTSGSEGSAPINNSVISVDYKSFKATWTEVVHINRERWRAKVPKEEKAKKEAEEKAR
LAAEEQQKEMEAKSQAEEGASGKAEKKTSGETKNQVNGTRANKSDNPRGKNSKAEKSSGE
QQQNGDFKDGKNKTDKKDHSNIGNDSKKTDGTKQRSHGSPAPSTSSTCRLTLPVIKPPLR
HFKRPAYASSSYAPSVSKKTDEHPARYKMLDQRIKMKKIQNISHNWNRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50397843
n/a
NameBDBM50397843
Synonyms:CHEMBL2179100
TypeSmall organic molecule
Emp. Form.C23H29N5O3
Mol. Mass.423.5081
SMILESCOc1ccc(CN2C[C@@H](C)[C@@H](C2)c2nc3n(ncc3c(=O)[nH]2)C2CCOCC2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: