| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lysophosphatidic acid receptor 1 |
|---|
| Ligand | BDBM50398117 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_873925 |
|---|
| IC50 | 985±n/a nM |
|---|
| Citation |  Qian Y; Hamilton M; Sidduri A; Gabriel S; Ren Y; Peng R; Kondru R; Narayanan A; Truitt T; Hamid R; Chen Y; Zhang L; Fretland AJ; Sanchez RA; Chang KC; Lucas M; Schoenfeld RC; Laine D; Fuentes ME; Stevenson CS; Budd DC Discovery of highly selective and orally active lysophosphatidic acid receptor-1 antagonists with potent activity on human lung fibroblasts. J Med Chem 55:7920-39 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lysophosphatidic acid receptor 1 |
|---|
| Name: | Lysophosphatidic acid receptor 1 |
|---|
| Synonyms: | LPA receptor 1 | LPA-1 | LPAR1 | Lysophosphatidic acid receptor 1 (LPA1) | Lysophosphatidic acid receptor Edg-2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41120.55 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q92633 |
|---|
| Residue: | 364 |
|---|
| Sequence: | MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
|
|
|
|---|
| BDBM50398117 |
|---|
| n/a |
|---|
| Name | BDBM50398117 |
|---|
| Synonyms: | CHEMBL2182036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H26N4O4 |
|---|
| Mol. Mass. | 434.4876 |
|---|
| SMILES | Cc1nnn(c1NC(=O)OC(C)(C)C)-c1ccc(cc1)-c1ccc(cc1)C1(CC1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
