| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-gamma serine/threonine-protein kinase |
|---|
| Ligand | BDBM50398360 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_875914 (CHEMBL2188027) |
|---|
| IC50 | 3±n/a nM |
|---|
| Citation |  Blake, JF; Xu, R; Bencsik, JR; Xiao, D; Kallan, NC; Schlachter, S; Mitchell, IS; Spencer, KL; Banka, AL; Wallace, EM; Gloor, SL; Martinson, M; Woessner, RD; Vigers, GP; Brandhuber, BJ; Liang, J; Safina, BS; Li, J; Zhang, B; Chabot, C; Do, S; Lee, L; Oeh, J; Sampath, D; Lee, BB; Lin, K; Liederer, BM; Skelton, NJ Discovery and preclinical pharmacology of a selective ATP-competitive Akt inhibitor (GDC-0068) for the treatment of human tumors. J Med Chem55:8110-27 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-gamma serine/threonine-protein kinase |
|---|
| Name: | RAC-gamma serine/threonine-protein kinase |
|---|
| Synonyms: | AKT3 | AKT3_HUMAN | PKB gamma | PKBG | Protein kinase Akt-3 | Protein kinase B (Akt 3) | Protein kinase B, gamma | RAC-PK-gamma | RAC-gamma serine/threonine-protein kinase | STK-2 | Serine/threonine-protein kinase AKT | Serine/threonine-protein kinase AKT3 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 55769.36 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 479 |
|---|
| Sequence: | MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
|
|
|
|---|
| BDBM50398360 |
|---|
| n/a |
|---|
| Name | BDBM50398360 |
|---|
| Synonyms: | CHEMBL2178597 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H33F4N5O2 |
|---|
| Mol. Mass. | 523.5661 |
|---|
| SMILES | C[C@@H]1C[C@@H](O)c2ncnc(N3CCN(CC3)C(=O)[C@H](CNC(C)(C)C)c3ccc(c(F)c3)C(F)(F)F)c12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
