| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50347750 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_875247 (CHEMBL2187129) |
|---|
| IC50 | >30000±n/a nM |
|---|
| Citation |  Tahtouh, T; Elkins, JM; Filippakopoulos, P; Soundararajan, M; Burgy, G; Durieu, E; Cochet, C; Schmid, RS; Lo, DC; Delhommel, F; Oberholzer, AE; Pearl, LH; Carreaux, F; Bazureau, JP; Knapp, S; Meijer, L Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B. J Med Chem55:9312-30 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41278.65 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
|---|
| Residue: | 358 |
|---|
| Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50347750 |
|---|
| n/a |
|---|
| Name | BDBM50347750 |
|---|
| Synonyms: | CHEMBL1802358 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H13N3O3 |
|---|
| Mol. Mass. | 307.3034 |
|---|
| SMILES | O=C1NC(Nc2ccccc2)=NC1=Cc1ccc2OCOc2c1 |w:13.15,c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
