Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-phosphorylation regulated kinase 2
LigandBDBM100152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_875250
IC50 120±n/a nM
Citation Tahtouh TElkins JMFilippakopoulos PSoundararajan MBurgy GDurieu ECochet CSchmid RSLo DCDelhommel FOberholzer AEPearl LHCarreaux FBazureau JPKnapp SMeijer L Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B. J Med Chem 55:9312-30 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-phosphorylation regulated kinase 2
Name:Dual-specificity tyrosine-phosphorylation regulated kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:66690.69
Organism:Homo sapiens (Human)
Description:ChEMBL_1508025
Residue:601
Sequence:
MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNA
AAAAHTIGGSKHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLP
VVPERQLDSIHRRQGSSTSLKSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPE
IYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVLKVIGKGSFGQVVKAY
DHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQG
RSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGG
RSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLP
KPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
S
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM100152
n/a
NameBDBM100152
Synonyms:7-methoxy-1-methyl-9H-beta-carboline;hydrochloride | 7-methoxy-1-methyl-9H-pyrido[3,4-b]indole;hydrochloride | HARMINE | Harmine hydrochloride | MLS002153910 | SMR001233259 | cid_5359389
TypeSmall organic molecule
Emp. Form.C13H12N2O
Mol. Mass.212.2472
SMILESCOc1ccc2c(c1)[nH]c1c(C)nccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: