Reaction Details |
| Report a problem with these data |
Target | Macrophage migration inhibitory factor |
---|
Ligand | BDBM50399054 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_878773 (CHEMBL2183713) |
---|
Ki | 43±n/a nM |
---|
Citation | Dahlgren, MK; Garcia, AB; Hare, AA; Tirado-Rives, J; Leng, L; Bucala, R; Jorgensen, WL Virtual screening and optimization yield low-nanomolar inhibitors of the tautomerase activity of Plasmodium falciparum macrophage migration inhibitory factor. J Med Chem55:10148-59 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Macrophage migration inhibitory factor |
---|
Name: | Macrophage migration inhibitory factor |
Synonyms: | Macrophage migration inhibitory factor (MIF) |
Type: | Enzyme |
Mol. Mass.: | 12844.38 |
Organism: | Plasmodium falciparum |
Description: | Q6Q3H7 |
Residue: | 116 |
Sequence: | MPCCEVITNVNLPDDNVQSTLSQIENAISDVMGKPLGYIMSNYDYQKNLRFGGSNEAYCF
VRITSIGGINRSNNSALADQITKLLVSNLNVKSRRIYVEFRDCSAQNFAFSGSLFG
|
|
|
BDBM50399054 |
---|
n/a |
---|
Name | BDBM50399054 |
Synonyms: | CHEMBL2178851 |
Type | Small organic molecule |
Emp. Form. | C17H20N2O3 |
Mol. Mass. | 300.3523 |
SMILES | COc1cccc(Oc2cc(C)nc(c2)N2CCOCC2)c1 |
Structure |
|