| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50399301 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_877313 (CHEMBL2188995) |
|---|
| IC50 | 75±n/a nM |
|---|
| Citation |  Boulahjar, R; Ouach, A; Matteo, C; Bourg, S; Ravache, M; le Guével, R; Marionneau, S; Oullier, T; Lozach, O; Meijer, L; Guguen-Guillouzo, C; Lazar, S; Akssira, M; Troin, Y; Guillaumet, G; Routier, S Novel tetrahydropyrido[1,2-a]isoindolone derivatives (valmerins): potent cyclin-dependent kinase/glycogen synthase kinase 3 inhibitors with antiproliferative activities and antitumor effects in human tumor xenografts. J Med Chem55:9589-606 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50399301 |
|---|
| n/a |
|---|
| Name | BDBM50399301 |
|---|
| Synonyms: | CHEMBL2180862 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18N4O2 |
|---|
| Mol. Mass. | 322.3611 |
|---|
| SMILES | O=C(Nc1ccccn1)Nc1cccc2C(=O)N3CCCCC3c12 |
|---|
| Structure | 
|
|---|
Search and Browse
