| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 5 activator 1 |
|---|
| Ligand | BDBM50399314 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_877316 (CHEMBL2188998) |
|---|
| IC50 | 700±n/a nM |
|---|
| Citation |  Boulahjar, R; Ouach, A; Matteo, C; Bourg, S; Ravache, M; le Guével, R; Marionneau, S; Oullier, T; Lozach, O; Meijer, L; Guguen-Guillouzo, C; Lazar, S; Akssira, M; Troin, Y; Guillaumet, G; Routier, S Novel tetrahydropyrido[1,2-a]isoindolone derivatives (valmerins): potent cyclin-dependent kinase/glycogen synthase kinase 3 inhibitors with antiproliferative activities and antitumor effects in human tumor xenografts. J Med Chem55:9589-606 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 5 activator 1 |
|---|
| Name: | Cyclin-dependent kinase 5 activator 1 |
|---|
| Synonyms: | CDK5/p35 | Cyclin-Dependent Kinase 5 (CDK5) | Cyclin-dependent kinase 5 regulatory subunit 1 | Cyclin-dependent kinase 5/CDK5 activator 1 |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Cyclin-dependent kinase 5 |
|---|
| Synonyms: | CDK5 | CDK5_HUMAN | CDKN5 | Cell division protein kinase 5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 | Cyclin-dependent-like kinase 5 (CDK5) | PSSALRE | Serine/threonine-protein kinase PSSALRE | Tau protein kinase II catalytic subunit |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33308.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 292 |
|---|
| Sequence: | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
|
|
|
|---|
| Component 2 |
| Name: | Cyclin-dependent kinase 5 activator 1 |
|---|
| Synonyms: | CD5R1_HUMAN | CDK5R | CDK5R1 | Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | Cyclin-dependent kinase 5 regulatory subunit 1 | NCK5A | TPKII regulatory subunit | p35 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34077.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15078 |
|---|
| Residue: | 307 |
|---|
| Sequence: | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
|
|
|
|---|
| BDBM50399314 |
|---|
| n/a |
|---|
| Name | BDBM50399314 |
|---|
| Synonyms: | CHEMBL2180850 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20N4O3 |
|---|
| Mol. Mass. | 388.4192 |
|---|
| SMILES | Oc1cccc2ccc(NC(=O)Nc3cccc4C(=O)N5CCCCC5c34)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
