| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50399638 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_878566 (CHEMBL2188651) |
|---|
| IC50 | 1.01±n/a nM |
|---|
| Citation |  Novoa, A; Van Dorpe, S; Wynendaele, E; Spetea, M; Bracke, N; Stalmans, S; Betti, C; Chung, NN; Lemieux, C; Zuegg, J; Cooper, MA; Tourwé, D; De Spiegeleer, B; Schiller, PW; Ballet, S Variation of the net charge, lipophilicity, and side chain flexibility in Dmt(1)-DALDA: Effect on Opioid Activity and Biodistribution. J Med Chem55:9549-61 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50399638 |
|---|
| n/a |
|---|
| Name | BDBM50399638 |
|---|
| Synonyms: | CHEMBL2181196 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H50N8O6 |
|---|
| Mol. Mass. | 654.8001 |
|---|
| SMILES | CN([C@@H](CCCCN)C(N)=O)C(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](CCCNC(N)=O)NC(=O)[C@@H](N)Cc1c(C)cc(O)cc1C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
