Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 1 (DGAT1)
LigandBDBM50399689
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876789
IC50 100±n/a nM
Citation Barlind JGBauer UABirch AMBirtles SBuckett LKButlin RJDavies RDEriksson JWHammond CDHovland RJohannesson PJohansson MJKemmitt PDLindmark BTMorentin Gutierrez PNoeske TANordin AO'Donnell CJPetersson AURedzic ATurnbull AVVinblad J Design and optimization of pyrazinecarboxamide-based inhibitors of diacylglycerol acyltransferase 1 (DGAT1) leading to a clinical candidate dimethylpyrazinecarboxamide phenylcyclohexylacetic acid (AZD7687). J Med Chem 55:10610-29 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 1 (DGAT1)
Name:Diacylglycerol O-acyltransferase 1 (DGAT1)
Synonyms:ACAT-related gene product 1 | Acyl coA-diacylglycerol acyl transferase 1 (DGAT1) | Diacylglycerol Acyltransferase (DGAT1) | Diacylglycerol O-acyltransferase 1 | Diglyceride acyltransferase
Type:Protein
Mol. Mass.:55297.82
Organism:Homo sapiens (Human)
Description:O75907
Residue:488
Sequence:
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399689
n/a
NameBDBM50399689
Synonyms:CHEMBL2178939
TypeSmall organic molecule
Emp. Form.C22H28N4O4S
Mol. Mass.444.547
SMILESCc1nc(C)c(nc1C(N)=O)-c1ccc(cc1)[C@H]1CC[C@H](CC(=O)NS(C)(=O)=O)CC1 |r,wU:17.18,wD:20.22,(3.84,-47.51,;5.17,-46.74,;6.52,-47.51,;7.84,-46.74,;9.18,-47.51,;7.84,-45.21,;6.51,-44.43,;5.18,-45.2,;3.84,-44.43,;2.51,-45.2,;3.84,-42.89,;9.17,-44.44,;10.51,-45.21,;11.84,-44.44,;11.84,-42.89,;10.5,-42.12,;9.17,-42.89,;13.17,-42.12,;13.16,-40.58,;14.5,-39.81,;15.84,-40.58,;17.17,-39.81,;18.51,-40.58,;18.51,-42.12,;19.84,-39.81,;21.17,-40.58,;22.51,-39.81,;20.77,-42.06,;21.93,-41.91,;15.84,-42.12,;14.51,-42.89,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: