Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 1 (DGAT1)
LigandBDBM50399692
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876789
IC50 1900±n/a nM
Citation Barlind JGBauer UABirch AMBirtles SBuckett LKButlin RJDavies RDEriksson JWHammond CDHovland RJohannesson PJohansson MJKemmitt PDLindmark BTMorentin Gutierrez PNoeske TANordin AO'Donnell CJPetersson AURedzic ATurnbull AVVinblad J Design and optimization of pyrazinecarboxamide-based inhibitors of diacylglycerol acyltransferase 1 (DGAT1) leading to a clinical candidate dimethylpyrazinecarboxamide phenylcyclohexylacetic acid (AZD7687). J Med Chem 55:10610-29 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 1 (DGAT1)
Name:Diacylglycerol O-acyltransferase 1 (DGAT1)
Synonyms:ACAT-related gene product 1 | Acyl coA-diacylglycerol acyl transferase 1 (DGAT1) | Diacylglycerol Acyltransferase (DGAT1) | Diacylglycerol O-acyltransferase 1 | Diglyceride acyltransferase
Type:Protein
Mol. Mass.:55297.82
Organism:Homo sapiens (Human)
Description:O75907
Residue:488
Sequence:
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399692
n/a
NameBDBM50399692
Synonyms:CHEMBL2178936
TypeSmall organic molecule
Emp. Form.C19H22N4O2
Mol. Mass.338.4036
SMILESNC(=O)C[C@H]1CC[C@@H](CC1)c1ccc(cc1)-c1cncc(n1)C(N)=O |r,wU:7.10,wD:4.3,(36.86,-29.48,;35.53,-30.25,;35.53,-31.79,;34.2,-29.48,;32.86,-30.25,;31.53,-29.49,;30.19,-30.26,;30.2,-31.79,;31.53,-32.56,;32.86,-31.8,;28.86,-32.57,;28.87,-34.12,;27.53,-34.89,;26.2,-34.12,;26.2,-32.57,;27.53,-31.8,;24.87,-34.89,;24.87,-36.42,;23.54,-37.19,;22.2,-36.42,;22.2,-34.88,;23.53,-34.11,;20.87,-34.11,;19.53,-34.88,;20.87,-32.57,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: