Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 1 (DGAT1)
LigandBDBM50399696
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876789
IC50>10000±n/a nM
Citation Barlind JGBauer UABirch AMBirtles SBuckett LKButlin RJDavies RDEriksson JWHammond CDHovland RJohannesson PJohansson MJKemmitt PDLindmark BTMorentin Gutierrez PNoeske TANordin AO'Donnell CJPetersson AURedzic ATurnbull AVVinblad J Design and optimization of pyrazinecarboxamide-based inhibitors of diacylglycerol acyltransferase 1 (DGAT1) leading to a clinical candidate dimethylpyrazinecarboxamide phenylcyclohexylacetic acid (AZD7687). J Med Chem 55:10610-29 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 1 (DGAT1)
Name:Diacylglycerol O-acyltransferase 1 (DGAT1)
Synonyms:ACAT-related gene product 1 | Acyl coA-diacylglycerol acyl transferase 1 (DGAT1) | Diacylglycerol Acyltransferase (DGAT1) | Diacylglycerol O-acyltransferase 1 | Diglyceride acyltransferase
Type:Protein
Mol. Mass.:55297.82
Organism:Homo sapiens (Human)
Description:O75907
Residue:488
Sequence:
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399696
n/a
NameBDBM50399696
Synonyms:CHEMBL2178932
TypeSmall organic molecule
Emp. Form.C26H27N3O3
Mol. Mass.429.5109
SMILESCc1nc(-c2ccccc2)c(nc1C(N)=O)-c1ccc(cc1)[C@H]1CC[C@H](CC(O)=O)CC1 |r,wU:22.24,wD:25.28,(19.12,-23.51,;20.45,-22.74,;21.79,-23.51,;23.12,-22.74,;24.45,-23.5,;24.45,-25.05,;25.78,-25.81,;27.12,-25.04,;27.11,-23.49,;25.78,-22.73,;23.12,-21.21,;21.78,-20.43,;20.45,-21.2,;19.12,-20.43,;17.78,-21.2,;19.12,-18.89,;24.45,-20.44,;25.78,-21.21,;27.12,-20.44,;27.11,-18.88,;25.78,-18.12,;24.45,-18.89,;28.45,-18.11,;28.44,-16.58,;29.78,-15.81,;31.11,-16.57,;32.45,-15.8,;33.78,-16.57,;35.11,-15.8,;33.78,-18.11,;31.11,-18.12,;29.78,-18.88,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: