Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSterol O-acyltransferase 1
LigandBDBM50399714
Substrate/Competitorn/a
Meas. Tech.ChEMBL_876785
IC50 15000±n/a nM
Citation Barlind JGBauer UABirch AMBirtles SBuckett LKButlin RJDavies RDEriksson JWHammond CDHovland RJohannesson PJohansson MJKemmitt PDLindmark BTMorentin Gutierrez PNoeske TANordin AO'Donnell CJPetersson AURedzic ATurnbull AVVinblad J Design and optimization of pyrazinecarboxamide-based inhibitors of diacylglycerol acyltransferase 1 (DGAT1) leading to a clinical candidate dimethylpyrazinecarboxamide phenylcyclohexylacetic acid (AZD7687). J Med Chem 55:10610-29 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sterol O-acyltransferase 1
Name:Sterol O-acyltransferase 1
Synonyms:Acetyl-CoA acetyltransferase, mitochondrial | Acyl coenzyme A:cholesterol acyltransferase 1 | Acyl-CoA: cholesterol acyltransferase (ACAT) | Acyl-coenzyme A:cholesterol acyltransferase 1 (ACAT1) | Cholesterol acyltransferase 1 | SOAT1
Type:Multi-pass membrane protein may form homo- or heterodimers.
Mol. Mass.:64751.94
Organism:Homo sapiens (Human)
Description:n/a
Residue:550
Sequence:
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE
LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK
IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK
FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT
YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR
VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW
NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM
FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR
PRSWTCRYVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50399714
n/a
NameBDBM50399714
Synonyms:CHEMBL2178371
TypeSmall organic molecule
Emp. Form.C22H25N3O3
Mol. Mass.379.4522
SMILESCc1nc(C)c(nc1C(N)=O)-c1ccc(cc1)C12CCC(CC1)(CC2)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: