Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetchemokine (C-X-C motif) receptor 3
LigandBDBM50310502
Substrate/Competitorn/a
Meas. Tech.ChEMBL_877964
Ki 10±n/a nM
Citation Wijtmans MScholten DJRoumen LCanals MCusters HGlas MVreeker MCde Kanter FJde Graaf CSmit MJde Esch IJLeurs R Chemical subtleties in small-molecule modulation of peptide receptor function: the case of CXCR3 biaryl-type ligands. J Med Chem 55:10572-83 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
chemokine (C-X-C motif) receptor 3
Name:chemokine (C-X-C motif) receptor 3
Synonyms:AAO92295.1 | C-X-C chemokine receptor type 3 | C-X-C chemokine receptor type 3 (CXCR3) | C-X-C chemokine receptor type 3 (CXCR3A) | CXCR3A
Type:Enzyme Catalytic Domain
Mol. Mass.:40665.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:368
Sequence:
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50310502
n/a
NameBDBM50310502
Synonyms:(R)-N-(1-(3-(4-ethoxyphenyl)-4-oxo-3,4-dihydropyrido[2,3-d]pyrimidin-2-yl)ethyl)-2-(4-fluoro-3-(trifluoromethyl)phenyl)-N-(pyridin-3-ylmethyl)acetamide | CHEMBL1077819
TypeSmall organic molecule
Emp. Form.C32H27F4N5O3
Mol. Mass.605.5821
SMILESCCOc1ccc(cc1)-n1c(nc2ncccc2c1=O)[C@@H](C)N(Cc1cccnc1)C(=O)Cc1ccc(F)c(c1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: