Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoamine oxidase
LigandBDBM50400130
Substrate/Competitorn/a
Meas. Tech.ChEMBL_878114
Ki 896±n/a nM
Citation Abdelhafez OMAmin KMAli HIAbdalla MMBatran RZ Synthesis of new 7-oxycoumarin derivatives as potent and selective monoamine oxidase A inhibitors. J Med Chem 55:10424-36 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Monoamine oxidase
Name:Monoamine oxidase
Synonyms:Amine oxidase [flavin-containing] B | MAO-B | Monoamine oxidase B | Monoamine oxidase type B
Type:PROTEIN
Mol. Mass.:58428.94
Organism:Bos taurus
Description:ChEMBL_1501478
Residue:520
Sequence:
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNHILRLSKELGLETYKVNEVERLIHHTKGKSYPFRGSFPSVWNPITYLDHNNLWR
TMDDMGREIPSDAPWKAPLAEQWDLMTMKELLDKICWTESSKQLAILFVNLCVTAEIHEV
SALWFLWYVKQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIHIDQ
TGENVLVETLNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVY
YKEPFWRNMDYCGSMIIEGEEAPVAYALDDTKPDGSYPAIIGFILAHKARKLARLTKEER
LKKLCDLYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTSYFPPGIMTQYGRVLRQPVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTT
FLQRHLPSVPGLLKLIGLTTIFSATALGFLAHKRGLLVRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400130
n/a
NameBDBM50400130
Synonyms:CHEMBL2178990
TypeSmall organic molecule
Emp. Form.C13H10N2O3S2
Mol. Mass.306.36
SMILESCc1cc(=O)oc2cc(OCc3nnc(S)s3)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: