Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-glutamine gamma-glutamyltransferase 2 (TG2)
LigandBDBM50400626
Substrate/Competitorn/a
Meas. Tech.ChEMBL_880185
IC50 54±n/a nM
Citation Wityak JPrime MEBrookfield FACourtney SMErfan SJohnsen SJohnson PDLi MMarston RWReed LVaidya DSchaertl SPedret-Dunn ABeconi MMacdonald DMuņoz-Sanjuan IDominguez C SAR Development of Lysine-Based Irreversible Inhibitors of Transglutaminase 2 for Huntington's Disease. ACS Med Chem Lett 3:1024-1028 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Name:Protein-glutamine gamma-glutamyltransferase 2 (TG2)
Synonyms:Protein-glutamine gamma-glutamyltransferase | Tissue transglutaminase | Tissue transglutaminase (TG2) | Transglutaminase 2 (TGM2) | Transglutaminase C | Transglutaminase-2
Type:Protein
Mol. Mass.:77309.30
Organism:Homo sapiens (Human)
Description:P21980
Residue:687
Sequence:
MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVHKSINRSL
IVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKYLLNLNLEPFSEK
SVPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50400626
n/a
NameBDBM50400626
Synonyms:CHEMBL2203467
TypeSmall organic molecule
Emp. Form.C28H35N3O4
Mol. Mass.477.5952
SMILESC=CC(=O)NCCCC[C@H](NC(=O)OCc1ccccc1)C(=O)N1CCC(CC1)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: