Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50400740 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_880513 (CHEMBL2211448) |
---|
Ki | 328±n/a nM |
---|
Citation | Yu, LF; Zhang, HK; Gunosewoyo, H; Kozikowski, AP From a4ß2 Nicotinic Ligands to the Discovery of s1 Receptor Ligands: Pharmacophore Analysis and Rational Design. ACS Med Chem Lett3:1054-1058 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50400740 |
---|
n/a |
---|
Name | BDBM50400740 |
Synonyms: | CHEMBL2165452 |
Type | Small organic molecule |
Emp. Form. | C14H16N2O3 |
Mol. Mass. | 260.2884 |
SMILES | C(Oc1cc(COc2ccccc2)no1)[C@@H]1CCN1 |r| |
Structure |
|