Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50064957
Substrate/Competitorn/a
Meas. Tech.ChEMBL_880516
Ki 3.6±n/a nM
Citation Yu LFZhang HKGunosewoyo HKozikowski AP From a42 Nicotinic Ligands to the Discovery of s1 Receptor Ligands: Pharmacophore Analysis and Rational Design. ACS Med Chem Lett 3:1054-1058 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50064957
n/a
NameBDBM50064957
Synonyms:CHEMBL76806 | N-(1-Benzyl-piperidin-4-yl)-2-(2-fluoro-phenyl)-acetamide
TypeSmall organic molecule
Emp. Form.C20H23FN2O
Mol. Mass.326.4078
SMILESFc1ccccc1CC(=O)NC1CCN(Cc2ccccc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: