Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDnaJ homolog subfamily A member 1
LigandBDBM50101929
Substrate/Competitorn/a
Meas. Tech.ChEMBL_879211
EC50 2±n/a nM
Citation Marsault EPeterson ML Macrocycles are great cycles: applications, opportunities, and challenges of synthetic macrocycles in drug discovery. J Med Chem 54:1961-2004 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DnaJ homolog subfamily A member 1
Name:DnaJ homolog subfamily A member 1
Synonyms:DNAJ2 | DNAJA1 | DnaJ protein homolog 2 | HDJ2 | HSDJ | HSJ-2 | HSJ2 | HSPF4 | Heat shock 40 kDa protein 4 | Heat shock protein J2 | Human DnaJ protein 2 | hDj-2
Type:PROTEIN
Mol. Mass.:44871.75
Organism:Homo sapiens (Human)
Description:ChEMBL_879211
Residue:397
Sequence:
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50101929
n/a
NameBDBM50101929
Synonyms:3-oxo-18-oxa-2,5,9,11-tetraazahexacyclo[17.6.2.22,5.113,17.07,11.022,26]triaconta-1(26),7,9,13(30),14,16,19(27),20,22,24-decaen-16-yl cyanide | 3-oxo-18-oxa-2,5,9,11-tetraazahexacyclo[17.6.2.22,5.113,17.07,11.022,26]triaconta-1(26),7,9,13,15,17(30),19(27),20,22,24-decaen-16-yl cyanide | 4-{5-[4-(3-Chloro-phenyl)-3-oxo-piperazin-1-ylmethyl]-imidazol-1-ylmethyl}-benzonitrile | CHEMBL52073
TypeSmall organic molecule
Emp. Form.C26H21N5O2
Mol. Mass.435.4772
SMILESO=C1CN2CCN1c1cccc3ccc(Oc4cc(Cn5cncc5C2)ccc4C#N)cc13
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: