Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDnaJ homolog subfamily A member 1
LigandBDBM50139187
Substrate/Competitorn/a
Meas. Tech.ChEMBL_879211
EC50 12±n/a nM
Citation Marsault EPeterson ML Macrocycles are great cycles: applications, opportunities, and challenges of synthetic macrocycles in drug discovery. J Med Chem 54:1961-2004 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DnaJ homolog subfamily A member 1
Name:DnaJ homolog subfamily A member 1
Synonyms:DNAJ2 | DNAJA1 | DnaJ protein homolog 2 | HDJ2 | HSDJ | HSJ-2 | HSJ2 | HSPF4 | Heat shock 40 kDa protein 4 | Heat shock protein J2 | Human DnaJ protein 2 | hDj-2
Type:PROTEIN
Mol. Mass.:44871.75
Organism:Homo sapiens (Human)
Description:ChEMBL_879211
Residue:397
Sequence:
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50139187
n/a
NameBDBM50139187
Synonyms:4-(2-cyclohexylethyl)-23-oxo-8-oxa-1,15,17,21-tetraazapentacyclo[19.2.2.13,7.19,13.015,19]heptacosa-3(27),4,6,9(26),10,12,16,18-octaen-10-yl cyanide | CHEMBL159171
TypeSmall organic molecule
Emp. Form.C31H35N5O2
Mol. Mass.509.6419
SMILESO=C1CN2CCN1Cc1cc(Oc3cc(Cn4cncc4C2)ccc3C#N)ccc1CCC1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: