| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM50400902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_880224 (CHEMBL2215353) |
|---|
| Ki | 220±n/a nM |
|---|
| Citation |  Bang-Andersen, B; Ruhland, T; Jørgensen, M; Smith, G; Frederiksen, K; Jensen, KG; Zhong, H; Nielsen, SM; Hogg, S; Mørk, A; Stensbøl, TB Discovery of 1-[2-(2,4-dimethylphenylsulfanyl)phenyl]piperazine (Lu AA21004): a novel multimodal compound for the treatment of major depressive disorder. J Med Chem54:3206-21 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5 | 5-HT-5A | 5-hydroxytryptamine receptor 5 (5-HT5) | 5-hydroxytryptamine receptor 5A (5-HT5A) | 5HT5A_HUMAN | HTR5A | Serotonin (5-HT) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40266.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P47898 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
|
|
|
|---|
| BDBM50400902 |
|---|
| n/a |
|---|
| Name | BDBM50400902 |
|---|
| Synonyms: | 1-(2-(2,4-dimethylphenylsulfanyl)phenyl)piperazine | CHEMBL2204360 | Lu-AA21004 | Trintellix | brintellix | vortioxetine hydrobromide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2S |
|---|
| Mol. Mass. | 298.446 |
|---|
| SMILES | Cc1ccc(Sc2ccccc2N2CCNCC2)c(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
