| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Histamine H2 receptor |
|---|
| Ligand | BDBM50400902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_880232 (CHEMBL2215361) |
|---|
| Ki | 180±n/a nM |
|---|
| Citation |  Bang-Andersen, B; Ruhland, T; Jørgensen, M; Smith, G; Frederiksen, K; Jensen, KG; Zhong, H; Nielsen, SM; Hogg, S; Mørk, A; Stensbøl, TB Discovery of 1-[2-(2,4-dimethylphenylsulfanyl)phenyl]piperazine (Lu AA21004): a novel multimodal compound for the treatment of major depressive disorder. J Med Chem54:3206-21 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Histamine H2 receptor |
|---|
| Name: | Histamine H2 receptor |
|---|
| Synonyms: | Gastric receptor I | H2R | HISTAMINE H2 | HRH2 | HRH2_HUMAN | Histamine H2 receptor | Histamine H2-Gs alpha S |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40115.31 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 359 |
|---|
| Sequence: | MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
|
|
|
|---|
| BDBM50400902 |
|---|
| n/a |
|---|
| Name | BDBM50400902 |
|---|
| Synonyms: | 1-(2-(2,4-dimethylphenylsulfanyl)phenyl)piperazine | CHEMBL2204360 | Lu-AA21004 | Trintellix | brintellix | vortioxetine hydrobromide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2S |
|---|
| Mol. Mass. | 298.446 |
|---|
| SMILES | Cc1ccc(Sc2ccccc2N2CCNCC2)c(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
