| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peripheral-Type Benzodiazepine Receptor |
|---|
| Ligand | BDBM50266889 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_879961 |
|---|
| Ki | 0.6±n/a nM |
|---|
| Citation |  Kumata K; Yui J; Hatori A; Fujinaga M; Yanamoto K; Yamasaki T; Kawamura K; Wakizaka H; Nengaki N; Yoshida Y; Ogawa M; Fukumura T; Zhang MR Synthesis and evaluation of novel carbon-11 labeled oxopurine analogues for positron emission tomography imaging of translocator protein (18 kDa) in peripheral organs. J Med Chem 54:6040-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peripheral-Type Benzodiazepine Receptor |
|---|
| Name: | Benzodiazepine receptors; peripheral & central |
|---|
| Synonyms: | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50266889 |
|---|
| n/a |
|---|
| Name | BDBM50266889 |
|---|
| Synonyms: | CHEMBL513922 | N-benzyl-N-ethyl-2-(7-methyl-8-oxo-2-phenyl-7H-purin-9(8H)-yl)acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H23N5O2 |
|---|
| Mol. Mass. | 401.461 |
|---|
| SMILES | CCN(Cc1ccccc1)C(=O)Cn1c2nc(ncc2n(C)c1=O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
