| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50054139 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_879961 (CHEMBL2212410) |
|---|
| Ki | 0.7±n/a nM |
|---|
| Citation |  Kumata, K; Yui, J; Hatori, A; Fujinaga, M; Yanamoto, K; Yamasaki, T; Kawamura, K; Wakizaka, H; Nengaki, N; Yoshida, Y; Ogawa, M; Fukumura, T; Zhang, MR Synthesis and evaluation of novel carbon-11 labeled oxopurine analogues for positron emission tomography imaging of translocator protein (18 kDa) in peripheral organs. J Med Chem54:6040-9 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | Benzodiazepine receptors; peripheral & central | Bzrp | Mbr | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor (PBR) | Peripheral-Type Benzodiazepine Receptor | TSPO_RAT | Tspo |
|---|
| Type: | Mitochondrion membrane protein |
|---|
| Mol. Mass.: | 18945.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competitive binding experiments were performed on rat kidney mitochondrial membranes. |
|---|
| Residue: | 169 |
|---|
| Sequence: | MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
|
|
|
|---|
| BDBM50054139 |
|---|
| n/a |
|---|
| Name | BDBM50054139 |
|---|
| Synonyms: | (R)1-(2-Chloro-phenyl)-isoquinoline-3-carboxylic acid sec-butyl-methyl-amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H21ClN2O |
|---|
| Mol. Mass. | 352.857 |
|---|
| SMILES | CC[C@@H](C)N(C)C(=O)c1cc2ccccc2c(n1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
