| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM50401097 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_884219 (CHEMBL2209449) |
|---|
| IC50 | 7±n/a nM |
|---|
| Citation |  Kaila, N; Huang, A; Moretto, A; Follows, B; Janz, K; Lowe, M; Thomason, J; Mansour, TS; Hubeau, C; Page, K; Morgan, P; Fish, S; Xu, X; Williams, C; Saiah, E Diazine indole acetic acids as potent, selective, and orally bioavailable antagonists of chemoattractant receptor homologous molecule expressed on Th2 cells (CRTH2) for the treatment of allergic inflammatory diseases. J Med Chem55:5088-109 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD294 antigen | Crth2 | G protein-coupled receptor 44 | Gpr44 | PD2R2_MOUSE | Ptgdr2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42975.89 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Human embryonic kidney (HEK) 293(EBNA) cells were transfected with mouse CRTH2. |
|---|
| Residue: | 382 |
|---|
| Sequence: | MANVTLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM
RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL
LSAISLDRCLQVVRPVWAQNHRTVAVAHRVCLMLWALAVLNTIPYFVFRDTIPRLDGRIM
CYYNLLLWNPGPDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLRLHHRGRQRT
GRFVRLVAAIVVAFVLCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP
LLYVFTCPDMLYKLRRSLRAVLESVLVEDSDQSGGLRNRRRRASSTATPASTLLLADRIP
QLRPTRLIGWMRRGSAEVPQRV
|
|
|
|---|
| BDBM50401097 |
|---|
| n/a |
|---|
| Name | BDBM50401097 |
|---|
| Synonyms: | CHEMBL2204469 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18F3N3O3 |
|---|
| Mol. Mass. | 441.4025 |
|---|
| SMILES | Cc1c(Cc2ccc(=O)n(Cc3ccc(F)cc3F)n2)c2cc(F)ccc2n1CC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
