Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase IV
LigandBDBM50401152
Substrate/Competitorn/a
Meas. Tech.ChEMBL_881163
IC50<10000±n/a nM
Citation Sunose MBell KEllard KBergamini GNeubauer GWerner TRamsden N Discovery of 5-(2-amino-[1,2,4]triazolo[1,5-a]pyridin-7-yl)-N-(tert-butyl)pyridine-3-sulfonamide (CZC24758), as a potent, orally bioavailable and selective inhibitor of PI3K for the treatment of inflammatory disease. Bioorg Med Chem Lett 22:4613-8 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase IV
Name:CaM kinase IV
Synonyms:CAM kinase-GR | CAMK4 | CaMK IV | Calcium/calmodulin-dependent protein kinase type IV
Type:PROTEIN
Mol. Mass.:51919.87
Organism:Homo sapiens (Human)
Description:ChEMBL_1459854
Residue:473
Sequence:
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401152
n/a
NameBDBM50401152
Synonyms:CHEMBL2205766
TypeSmall organic molecule
Emp. Form.C15H18N6O2S
Mol. Mass.346.407
SMILESCC(C)(C)NS(=O)(=O)c1cncc(c1)-c1ccn2nc(N)nc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: