Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSonic hedgehog protein
LigandBDBM50401326
Substrate/Competitorn/a
Meas. Tech.ChEMBL_883326
IC50 6.9±n/a nM
Citation Ohashi TOguro YTanaka TShiokawa ZTanaka YShibata SSato YYamakawa HHattori HYamamoto YKondo SMiyamoto MNishihara MIshimura YTojo HBaba ASasaki S Discovery of the investigational drug TAK-441, a pyrrolo[3,2-c]pyridine derivative, as a highly potent and orally active hedgehog signaling inhibitor: modification of the core skeleton for improved solubility. Bioorg Med Chem 20:5507-17 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sonic hedgehog protein
Name:Sonic hedgehog protein
Synonyms:n/a
Type:Protein
Mol. Mass.:47784.50
Organism:Mus musculus (Mouse)
Description:Q62226
Residue:437
Sequence:
MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEARGAEPTAGIHWYSQLLYHIGTW
LLDSETMHPLGMAVKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401326
n/a
NameBDBM50401326
Synonyms:CHEMBL2205227
TypeSmall organic molecule
Emp. Form.C28H34N4O6
Mol. Mass.522.5928
SMILESCCOc1c(C(=O)NC2CCN(CC2)C(=O)CO)n(C)c2cc(CC)n(CC(=O)c3ccccc3)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: