Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlucose regulated protein 94kDa (Grp94)
LigandBDBM50401333
Substrate/Competitorn/a
Meas. Tech.ChEMBL_883817
Ki 61±n/a nM
Citation Shi JVan de Water RHong KLamer RBWeichert KWSandoval CMKasibhatla SRBoehm MFChao JLundgren KTimple NLough RIbanez GBoykin CBurrows FJKehry MRYun TJHarning EKAmbrose CThompson JBixler SADunah ASnodgrass-Belt PArndt JEnyedy IJLi PHong VSMcKenzie ABiamonte MA EC144 is a potent inhibitor of the heat shock protein 90. J Med Chem 55:7786-95 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glucose regulated protein 94kDa (Grp94)
Name:Glucose regulated protein 94kDa (Grp94)
Synonyms:Endoplasmin
Type:Protein
Mol. Mass.:92417.36
Organism:Homo sapiens (Human)
Description:P14625
Residue:803
Sequence:
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
EMDVGTDEEEETAKESTAEKDEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401333
n/a
NameBDBM50401333
Synonyms:CHEMBL1230584
TypeSmall organic molecule
Emp. Form.C21H24ClN5O2
Mol. Mass.413.901
SMILESCOc1c(C)cnc(Cn2cc(C#CCC(C)(C)O)c3c(Cl)nc(N)nc23)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: