Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 5
LigandBDBM50042874
Substrate/Competitorn/a
Meas. Tech.ChEMBL_884038
EC50 19000±n/a nM
Citation Thiele SMalmgaard-Clausen MEngel-Andreasen JSteen ARummel PCNielsen MCGloriam DEFrimurer TMUlven TRosenkilde MM Modulation in selectivity and allosteric properties of small-molecule ligands for CC-chemokine receptors. J Med Chem 55:8164-77 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 5
Name:CCR5/mu opioid receptor complex
Synonyms:C-C CKR-5 | CC-CKR-5 | CCR-5 | CCR5/mu opioid receptor complex | CD_antigen=CD195 | CHEMR13 | HIV-1 fusion coreceptor
Type:Enzyme
Mol. Mass.:40540.21
Organism:Homo sapiens (Human)
Description:P51681
Residue:352
Sequence:
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKR
LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII
LLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSS
HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI
MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50042874
n/a
NameBDBM50042874
Synonyms:2,2'-Bipyridin | 2,2'-bipyridine | 2,2'-bipyridyl | 2,2'-dipyridine | 2,2'-dipyridyl | 2-(2-pyridyl)pyridine | CHEMBL39879 | US10196346, Bipyridine | alpha,alpha'-bipyridine | alpha,alpha'-bipyridyl | alpha,alpha'-dipyridine | alpha,alpha'-dipyridyl | bpy
TypeSmall organic molecule
Emp. Form.C10H8N2
Mol. Mass.156.1839
SMILESc1ccc(nc1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: