Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-C chemokine receptor type 1
LigandBDBM38924
Substrate/Competitorn/a
Meas. Tech.ChEMBL_884039
EC50 64000±n/a nM
Citation Thiele SMalmgaard-Clausen MEngel-Andreasen JSteen ARummel PCNielsen MCGloriam DEFrimurer TMUlven TRosenkilde MM Modulation in selectivity and allosteric properties of small-molecule ligands for CC-chemokine receptors. J Med Chem 55:8164-77 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-C chemokine receptor type 1
Name:C-C chemokine receptor type 1
Synonyms:C-C CKR-1 | C-C chemokine receptor type 1 (CCR1) | CC-CKR-1 | CCR-1 | CCR1 | CD_antigen=CD191 | HM145 | LD78 receptor | MIP-1alpha-R | Macrophage inflammatory protein 1-alpha receptor | RANTES-R
Type:Enzyme
Mol. Mass.:41180.69
Organism:Homo sapiens (Human)
Description:P32246
Residue:355
Sequence:
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM38924
n/a
NameBDBM38924
Synonyms:2,6-bis(2-pyridinyl)pyridine | 2,6-bis(2-pyridyl)pyridine | 2,6-dipyridin-2-ylpyridine | MLS000048666 | SMR000060049 | cid_70848
TypeSmall organic molecule
Emp. Form.C15H11N3
Mol. Mass.233.2679
SMILESc1ccc(nc1)-c1cccc(n1)-c1ccccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: