Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50359807 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_887293 (CHEMBL2216272) |
---|
IC50 | 7500±n/a nM |
---|
Citation | Lainchbury, M; Matthews, TP; McHardy, T; Boxall, KJ; Walton, MI; Eve, PD; Hayes, A; Valenti, MR; de Haven Brandon, AK; Box, G; Aherne, GW; Reader, JC; Raynaud, FI; Eccles, SA; Garrett, MD; Collins, I Discovery of 3-alkoxyamino-5-(pyridin-2-ylamino)pyrazine-2-carbonitriles as selective, orally bioavailable CHK1 inhibitors. J Med Chem55:10229-40 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50359807 |
---|
n/a |
---|
Name | BDBM50359807 |
Synonyms: | CHEMBL1928705 |
Type | Small organic molecule |
Emp. Form. | C19H19ClN6O |
Mol. Mass. | 382.847 |
SMILES | C[C@H](CN(C)C)Oc1nc(Nc2cc3cccc(Cl)c3cn2)cnc1C#N |r| |
Structure |
|