Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50401859 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_886105 (CHEMBL2210027) |
---|
IC50 | 36.1±n/a nM |
---|
Citation | Riganas, S; Papanastasiou, I; Foscolos, GB; Tsotinis, A; Serin, G; Mirjolet, JF; Dimas, K; Kourafalos, VN; Eleutheriades, A; Moutsos, VI; Khan, H; Georgakopoulou, S; Zaniou, A; Prassa, M; Theodoropoulou, M; Mantelas, A; Pondiki, S; Vamvakides, A New adamantane phenylalkylamines withs-receptor binding affinity and anticancer activity, associated with putative antagonism of neuropathic pain. J Med Chem55:10241-61 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50401859 |
---|
n/a |
---|
Name | BDBM50401859 |
Synonyms: | CHEMBL2204677 |
Type | Small organic molecule |
Emp. Form. | C37H46N2 |
Mol. Mass. | 518.7745 |
SMILES | C(CN1CCN(Cc2ccccc2)CC1)Cc1ccc(cc1)C(c1ccccc1)C12CC3CC(CC(C3)C1)C2 |TLB:22:29:32.31.36:34,THB:22:29:32:36.35.34,37:29:32:36.35.34,37:35:32:38.30.29,30:31:34:38.29.37,30:29:32.31.36:34| |
Structure |
|