Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H2 Receptor
LigandBDBM50401946
Substrate/Competitorn/a
Meas. Tech.ChEMBL_886463
Ki 6100±n/a nM
Citation Löber SHübner HBuschauer ASanna FArgiolas AMelis MRGmeiner P Novel azulene derivatives for the treatment of erectile dysfunction. Bioorg Med Chem Lett 22:7151-4 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H2 Receptor
Name:Histamine H2 receptor
Synonyms:Gastric receptor I | H2R | HISTAMINE H2 | Histamine H2-Gs alpha S
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:40115.31
Organism:Homo sapiens (Human)
Description:n/a
Residue:359
Sequence:
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50401946
n/a
NameBDBM50401946
Synonyms:CHEMBL2207639
TypeSmall organic molecule
Emp. Form.C27H33N3O2
Mol. Mass.431.5698
SMILESCOc1ccccc1N1CCN(Cc2cc(CN3CCOCC3)c3cccccc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: